Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS18 Peptide - middle region

RGS18 Peptide - middle region

Product Specifications

Product Name Alternative

RGS13

UniProt

Q9NS28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGS18 Rabbit Polyclonal Antibody (orb330259) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570138

Preservative

Lyophilized powder

AA Sequence

EDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SOS1 Antibody
RC-15578-01 50 μL

Recombinant SOS1 Antibody

Sign In for Pricing
View Details
Recombinant SOS1 Antibody
RC-15578-02 100 µL

Recombinant SOS1 Antibody

Sign In for Pricing
View Details
Recombinant SOS1 Antibody
RC-15578-03 1 mL

Recombinant SOS1 Antibody

Sign In for Pricing
View Details
VWA5B2 Human Gene Knockout Kit (CRISPR)
KN426871 1 Kit

VWA5B2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Coatomer subunit delta (ARCN1) (NM_001655) Human Over-expression Lysate
LY400624 100 µg

Coatomer subunit delta (ARCN1) (NM_001655) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Nitrobenzyl 1-Thio-Beta-D-galactopryranoside
TRC-N495750-250MG 250 mg

4-Nitrobenzyl 1-Thio-Beta-D-galactopryranoside

Sign In for Pricing
View Details