Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rgs2 Peptide - N-terminal region

Rgs2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GOS8

UniProt

P41220

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rgs2 Rabbit Polyclonal Antibody (orb578614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_033087

Preservative

Lyophilized powder

AA Sequence

NSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Ser (t-Bu) Wang Resin
H0370751323.25G 25 g

Fmoc-Ser (t-Bu) Wang Resin

Sign In for Pricing
View Details
NUDT18 (NM_024815) Human Over-expression Lysate
LC403033 20 µg

NUDT18 (NM_024815) Human Over-expression Lysate

Sign In for Pricing
View Details
Plexin D1 (PLXND1) Human Gene Knockout Kit (CRISPR)
KN216518 1 Kit

Plexin D1 (PLXND1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561370 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Xanthopterin Hydrate
TRC-X742003-100MG 100 mg

Xanthopterin Hydrate

Sign In for Pricing
View Details
CD137, Mouse (LOB12), 0.2mg/mL
BNUB2012-500 1x 500 µL

CD137, Mouse (LOB12), 0.2mg/mL

Sign In for Pricing
View Details