Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rgs2 Peptide - N-terminal region

Rgs2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GOS8

UniProt

P41220

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rgs2 Rabbit Polyclonal Antibody (orb578614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_033087

Preservative

Lyophilized powder

AA Sequence

NSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C8]
TA800705AM 100 µL

ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C8]

Sign In for Pricing
View Details
6-cyclopropyl-2-oxo-1,2-dihydropyridine-4-carboxylic acid
TRC-B427845-25MG 25 mg

6-cyclopropyl-2-oxo-1,2-dihydropyridine-4-carboxylic acid

Sign In for Pricing
View Details
ZNHIT1 antibody
FNab09744 100 µg

ZNHIT1 antibody

Sign In for Pricing
View Details
EnzyChrom™ NAD/NADH Assay Kit
E2ND-100 100 Tests

EnzyChrom™ NAD/NADH Assay Kit

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2865), CF647 conjugate, 0.1mg/mL
BNC472865-500 1x 500 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/2865), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CARMIL3 activation kit by CRISPRa
GA114050 1 Kit

Human CARMIL3 activation kit by CRISPRa

Sign In for Pricing
View Details