Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGS4 Peptide - C-terminal region

RGS4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp761F1924, MGC2124, MGC60244, RGP4, SCZD9

UniProt

A7XA59

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGS4 Rabbit Polyclonal Antibody (orb573629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001095915

Preservative

Lyophilized powder

AA Sequence

IFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Lin7A Protein
ARP2822-01 10 µg

Recombinant Human Lin7A Protein

Sign In for Pricing
View Details
Recombinant Human Lin7A Protein
ARP2822-02 50 µg

Recombinant Human Lin7A Protein

Sign In for Pricing
View Details
Recombinant Human Lin7A Protein
ARP2822-03 100 µg

Recombinant Human Lin7A Protein

Sign In for Pricing
View Details
Recombinant Human Lin7A Protein
ARP2822-04 1 mg

Recombinant Human Lin7A Protein

Sign In for Pricing
View Details
HSPD1P11 AAV Vector (Human) (CMV)
24032101 1 µg

HSPD1P11 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PT7-GDF15-EGFP-6xHis Plasmid
PVT72055 2 µg

PT7-GDF15-EGFP-6xHis Plasmid

Sign In for Pricing
View Details