Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHBG Peptide - N-terminal region

RHBG Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLC42A2

UniProt

Q9H310

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHBG Rabbit Polyclonal Antibody (orb330589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065140

Preservative

Lyophilized powder

AA Sequence

RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NP protein
NCP0028P 1 mg

NP protein

Sign In for Pricing
View Details
Compound NP-020943
MBS5793760 Inquire

Compound NP-020943

Sign In for Pricing
View Details
Mouse Monoclonal NKIRAS1 Antibody (184C278) [Alexa Fluor 647]
NB100-56555AF647 0.1 mL

Mouse Monoclonal NKIRAS1 Antibody (184C278) [Alexa Fluor 647]

Sign In for Pricing
View Details
R-Cadherin (PT2127) Antibody
MBS9527257-01 0.02 mL

R-Cadherin (PT2127) Antibody

Sign In for Pricing
View Details
R-Cadherin (PT2127) Antibody
MBS9527257-02 0.05 mL

R-Cadherin (PT2127) Antibody

Sign In for Pricing
View Details
R-Cadherin (PT2127) Antibody
MBS9527257-03 0.1 mL

R-Cadherin (PT2127) Antibody

Sign In for Pricing
View Details