Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHBG Peptide - N-terminal region

RHBG Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLC42A2

UniProt

Q9H310

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHBG Rabbit Polyclonal Antibody (orb330589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065140

Preservative

Lyophilized powder

AA Sequence

RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FRMPD3 Antibody [Alexa Fluor 532]
NBP2-81718AF532 0.1 mL

Rabbit Polyclonal FRMPD3 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
G-Protein Coupled Receptor 153 (GPR153, DKFZP762B2210, PGR1) discontinued
G8601-57 50 µg

G-Protein Coupled Receptor 153 (GPR153, DKFZP762B2210, PGR1) discontinued

Sign In for Pricing
View Details
IgG, Fc discontinued
I1904-57K 1 mg

IgG, Fc discontinued

Sign In for Pricing
View Details
N-Ethylnicotinamide
TRC-E925835-25G 25 g

N-Ethylnicotinamide

Sign In for Pricing
View Details
Tlcd1 (NM_001013858) Rat Tagged ORF Clone Lentiviral Particle
RR213329L3V 200 µL

Tlcd1 (NM_001013858) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TARBP2 Rabbit pAb
E2507533 100 µL

TARBP2 Rabbit pAb

Sign In for Pricing
View Details