Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHD Peptide - C-terminal region

RHD Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-335G20.5, CD240D, DIIIc, MGC165007, RH, RH30, RHCED, RHDVA (TT), RHDel, RHPII, RHXIII, Rh4, RhDCw, RhII, RhK562-II, RhPI

UniProt

B2LR45

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHD Rabbit Polyclonal Antibody (orb585523) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

ACB87205

Preservative

Lyophilized powder

AA Sequence

DYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGAP6 (NM_001077665) Human Over-expression Lysate
LY421474 100 µg

AGAP6 (NM_001077665) Human Over-expression Lysate

Sign In for Pricing
View Details
EFNA3 Antibody
8C10709-AAT 50 µg

EFNA3 Antibody

Sign In for Pricing
View Details
Recombinant Human IFN gamma
6451 5 µg

Recombinant Human IFN gamma

Sign In for Pricing
View Details
OSBPL9 (NM_148905) Human Recombinant Protein
TP760439 50 µg

OSBPL9 (NM_148905) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human ERP72/PDIA4 Protein (aa 1-641, His Tag)
PKSH030654 100 µg

Recombinant Human ERP72/PDIA4 Protein (aa 1-641, His Tag)

Sign In for Pricing
View Details
GPR 150 (GPR150) Human Gene Knockout Kit (CRISPR)
KN423227 1 Kit

GPR 150 (GPR150) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details