Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHD Peptide - N-terminal region

RHD Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD240D, DIIIc, MGC165007, RH, RH30, RHCED, RHDVA (TT), RHDel, RHPII, RHXIII, Rh4, RhDCw, RhII, RhK562-II, RhPI

UniProt

Q5XLT3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHD Rabbit Polyclonal Antibody (orb585524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121163

Preservative

Lyophilized powder

AA Sequence

WALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLPS Rabbit Polyclonal Antibody (RBITC)
orb1057764 100 µL

CLPS Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
LYPD2
CSB-CL761498HU 10 μg Plasmid + 200 μL Glycerol

LYPD2

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 324B (ZNF324B)
MBS1292356-01 0.02 mg (E-Coli)

Recombinant Human Zinc finger protein 324B (ZNF324B)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 324B (ZNF324B)
MBS1292356-02 0.02 mg (Yeast)

Recombinant Human Zinc finger protein 324B (ZNF324B)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 324B (ZNF324B)
MBS1292356-03 0.1 mg (E-Coli)

Recombinant Human Zinc finger protein 324B (ZNF324B)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 324B (ZNF324B)
MBS1292356-04 0.1 mg (Yeast)

Recombinant Human Zinc finger protein 324B (ZNF324B)

Sign In for Pricing
View Details