Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHD Peptide - N-terminal region

RHD Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD240D, DIIIc, MGC165007, RH, RH30, RHCED, RHDVA (TT), RHDel, RHPII, RHXIII, Rh4, RhDCw, RhII, RhK562-II, RhPI

UniProt

Q5XLT3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHD Rabbit Polyclonal Antibody (orb585524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121163

Preservative

Lyophilized powder

AA Sequence

WALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 3/CLDN3 Rabbit Polyclonal Antibody (Carrier-free)
orb3105792 100 µg

Claudin 3/CLDN3 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Complement Fragment C4b (C4b) Antibody (HRP)
abx335169-01 20 µg

Complement Fragment C4b (C4b) Antibody (HRP)

Sign In for Pricing
View Details
Complement Fragment C4b (C4b) Antibody (HRP)
abx335169-02 50 µg

Complement Fragment C4b (C4b) Antibody (HRP)

Sign In for Pricing
View Details
Complement Fragment C4b (C4b) Antibody (HRP)
abx335169-03 100 µg

Complement Fragment C4b (C4b) Antibody (HRP)

Sign In for Pricing
View Details
Complement Fragment C4b (C4b) Antibody (HRP)
abx335169-04 200 µg

Complement Fragment C4b (C4b) Antibody (HRP)

Sign In for Pricing
View Details
Complement Fragment C4b (C4b) Antibody (HRP)
abx335169-05 1 mg

Complement Fragment C4b (C4b) Antibody (HRP)

Sign In for Pricing
View Details