Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rhebl1 Peptide - N-terminal region

Rhebl1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1810036J22Rik

UniProt

Q9D8T3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rhebl1 Rabbit Polyclonal Antibody (orb581798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081243

Preservative

Lyophilized powder

AA Sequence

VEGEFLEGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQDEYSILPYSLII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlorotriphenylstannane
TRC-C422250-250MG 250 mg

Chlorotriphenylstannane

Sign In for Pricing
View Details
TECPR2 (NM_001172631) Human Over-expression Lysate
LC433686 20 µg

TECPR2 (NM_001172631) Human Over-expression Lysate

Sign In for Pricing
View Details
7-Benzoyloxindole
TRC-B208155-50MG 50 mg

7-Benzoyloxindole

Sign In for Pricing
View Details
Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit
E-CL-M0236-01 24 Tests

Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit

Sign In for Pricing
View Details
Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit
E-CL-M0236-02 48 Tests

Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit

Sign In for Pricing
View Details
Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit
E-CL-M0236-03 96 Tests

Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit

Sign In for Pricing
View Details