Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rhebl1 Peptide - N-terminal region

Rhebl1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1810036J22Rik

UniProt

Q9D8T3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rhebl1 Rabbit Polyclonal Antibody (orb581798) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081243

Preservative

Lyophilized powder

AA Sequence

VEGEFLEGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQDEYSILPYSLII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Ile Wang Resin LL
HLL0751501315.25G 25 g

Fmoc-Ile Wang Resin LL

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Tulipa sp. Lectin (Tulip) -TL-
LA-8001-1 1 mg

Alkaline Phosphatase Conjugated Tulipa sp. Lectin (Tulip) -TL-

Sign In for Pricing
View Details
Human Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2) ELISA Kit
RDR-PLCg2-Hu-01 96 Tests

Human Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2) ELISA Kit
RDR-PLCg2-Hu-02 48 Tests

Human Phospholipase C Gamma 2, Phosphatidylinositol Specific (PLCg2) ELISA Kit

Sign In for Pricing
View Details
PE Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182D-01 50 Tests

PE Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
PE Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182D-02 100 Tests

PE Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details