Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHO Peptide - C-terminal region

RHO Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSNBAD1, MGC138309, MGC138311, OPN2, RP4

UniProt

P08100

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHO Rabbit Polyclonal Antibody (orb584504) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000530

Preservative

Lyophilized powder

AA Sequence

QDVILEVIYTDPVDLSVGTVAEITGHQLMSLSTANAKKDPSCKTCNISVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

URG4 (URGCP) Rabbit Polyclonal Antibody
TA372079 100 µL

URG4 (URGCP) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,2-Ethylene Glycol (Ethylene Glycol)
TRC-E890140-25ML 25 mL

1,2-Ethylene Glycol (Ethylene Glycol)

Sign In for Pricing
View Details
Tylvalosin-d9
TRC-T898212-10MG 10 mg

Tylvalosin-d9

Sign In for Pricing
View Details
SERBP1 (NM_001018068) Human Over-expression Lysate
LC422719 20 µg

SERBP1 (NM_001018068) Human Over-expression Lysate

Sign In for Pricing
View Details
Human β-EPR (Beta-Endorphin Receptor) CLIA Kit
E-CL-H0445-01 24 Tests

Human β-EPR (Beta-Endorphin Receptor) CLIA Kit

Sign In for Pricing
View Details
Human β-EPR (Beta-Endorphin Receptor) CLIA Kit
E-CL-H0445-02 48 Tests

Human β-EPR (Beta-Endorphin Receptor) CLIA Kit

Sign In for Pricing
View Details