Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHO Peptide - C-terminal region

RHO Peptide - C-terminal region

Product Specifications

Product Name Alternative

CSNBAD1, MGC138309, MGC138311, OPN2, RP4

UniProt

P08100

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHO Rabbit Polyclonal Antibody (orb584504) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000530

Preservative

Lyophilized powder

AA Sequence

QDVILEVIYTDPVDLSVGTVAEITGHQLMSLSTANAKKDPSCKTCNISVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDAP1L1 Human Gene Knockout Kit (CRISPR)
KN400976 1 Kit

GDAP1L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SphI, 50 preps
FDRV1340 50 Preparations

SphI, 50 preps

Sign In for Pricing
View Details
EVI5L (NM_145245) Human Recombinant Protein
TP304363 20 µg

EVI5L (NM_145245) Human Recombinant Protein

Sign In for Pricing
View Details
Rap2c (BC064814) Mouse Tagged ORF Clone
MG201661 10 µg

Rap2c (BC064814) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559615 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Recombinant COX6C Antibody
RC-4849-01 50 μL

Recombinant COX6C Antibody

Sign In for Pricing
View Details