Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOB Peptide - middle region

RHOB Peptide - middle region

Product Specifications

Product Name Alternative

ARH6, ARHB, MST081, MSTP081, RHOH6

UniProt

P62745

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHOB Rabbit Polyclonal Antibody (orb582442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004031

Preservative

Lyophilized powder

AA Sequence

CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Zinc finger protein 582 (ZNF582)
MBS1448828-01 0.02 mg (E-Coli)

Recombinant Human Zinc finger protein 582 (ZNF582)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 582 (ZNF582)
MBS1448828-02 0.02 mg (Yeast)

Recombinant Human Zinc finger protein 582 (ZNF582)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 582 (ZNF582)
MBS1448828-03 0.1 mg (E-Coli)

Recombinant Human Zinc finger protein 582 (ZNF582)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 582 (ZNF582)
MBS1448828-04 0.1 mg (Yeast)

Recombinant Human Zinc finger protein 582 (ZNF582)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 582 (ZNF582)
MBS1448828-05 0.02 mg (Baculovirus)

Recombinant Human Zinc finger protein 582 (ZNF582)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 582 (ZNF582)
MBS1448828-06 0.02 mg (Mammalian-Cell)

Recombinant Human Zinc finger protein 582 (ZNF582)

Sign In for Pricing
View Details