Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOG Peptide - C-terminal region

RHOG Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARHG, MGC125835, MGC125836

UniProt

P84095

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHOG Rabbit Polyclonal Antibody (orb584604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001656

Preservative

Lyophilized powder

AA Sequence

LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary
CS700467 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD203c Antibody[NP4D6]
E-AB-F1297L-01 20 Tests

Elab Fluor® 488 Anti-Human CD203c Antibody[NP4D6]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD203c Antibody[NP4D6]
E-AB-F1297L-02 100 Tests

Elab Fluor® 488 Anti-Human CD203c Antibody[NP4D6]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD203c Antibody[NP4D6]
E-AB-F1297L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD203c Antibody[NP4D6]

Sign In for Pricing
View Details
DOK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]
TA813133BM 100 µL

DOK3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]

Sign In for Pricing
View Details
RASGRP3 (NM_170672) Human Over-expression Lysate
LC403524 20 µg

RASGRP3 (NM_170672) Human Over-expression Lysate

Sign In for Pricing
View Details