RHOG Peptide - C-terminal region
RHOG Peptide - C-terminal region
Product Specifications
Product Name Alternative
ARHG, MGC125835, MGC125836
UniProt
P84095
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RHOG Rabbit Polyclonal Antibody (orb584604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001656
Preservative
Lyophilized powder
AA Sequence
LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880002-100 1x 100 µL
CD66 (CEA) (COL-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742105-500 1x 500 µL
Myoglobin (Muscle Cell Marker) (MB/2105), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH032834-01 10 µg
Recombinant Human Oncomodulin-1/OCM Protein (His Tag)
Sign In for Pricing
View Details PKSH032834-02 50 µg
Recombinant Human Oncomodulin-1/OCM Protein (His Tag)
Sign In for Pricing
View Details 
