Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOJ Peptide - middle region

RHOJ Peptide - middle region

Product Specifications

Product Name Alternative

ARHJ, FLJ14445, MGC34777, RASL7B, TC10B, TCL

UniProt

Q9ER71

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHOJ Rabbit Polyclonal Antibody (orb583565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065714

Preservative

Lyophilized powder

AA Sequence

LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gls2-set siRNA/shRNA/RNAi Lentivector (Rat)
21630096 4x 500 ng

Gls2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Anti-Histone H2A (Acetyl Lys15) antibody
STJ97173 200 µl

Anti-Histone H2A (Acetyl Lys15) antibody

Sign In for Pricing
View Details
SPICE1 Rabbit pAb
A7855-01 20 µL

SPICE1 Rabbit pAb

Sign In for Pricing
View Details
SPICE1 Rabbit pAb
A7855-02 100 μL

SPICE1 Rabbit pAb

Sign In for Pricing
View Details
SPICE1 Rabbit pAb
A7855-03 500 μL

SPICE1 Rabbit pAb

Sign In for Pricing
View Details
SPICE1 Rabbit pAb
A7855-04 1000 μL

SPICE1 Rabbit pAb

Sign In for Pricing
View Details