Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOJ Peptide - middle region

RHOJ Peptide - middle region

Product Specifications

Product Name Alternative

ARHJ, FLJ14445, MGC34777, RASL7B, TC10B, TCL

UniProt

Q9ER71

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHOJ Rabbit Polyclonal Antibody (orb583565) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065714

Preservative

Lyophilized powder

AA Sequence

LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Jejuni rplK Protein (aa 1-141) (strain 81116 / NCTC 11828)
VAng-Ly2336-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni rplK Protein (aa 1-141) (strain 81116 / NCTC 11828)

Sign In for Pricing
View Details
pEGFP-P65 Plasmid
PVT10284 2 µg

pEGFP-P65 Plasmid

Sign In for Pricing
View Details
UGT2B7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
49146061 1.0 µg DNA

UGT2B7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Vertical Laminar Airflow BLVR-201
BLVR-201 1 Unit

Vertical Laminar Airflow BLVR-201

Sign In for Pricing
View Details
Digoxigenin-dUTP, Alkali Stable
#40078 1x 25 nmol

Digoxigenin-dUTP, Alkali Stable

Sign In for Pricing
View Details
LOC81691 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
27518061 1.0 µg DNA

LOC81691 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details