Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOXF1 Peptide - C-terminal region

RHOXF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119030, MGC119033, OTEX, PEPP1

UniProt

Q8NHV9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHOXF1 Rabbit Polyclonal Antibody (orb577306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_644811

Preservative

Lyophilized powder

AA Sequence

ELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus subtilis SPBc2 prophage-derived protein BhlB (bhlB)
MBS1061886 Inquire

Recombinant Bacillus subtilis SPBc2 prophage-derived protein BhlB (bhlB)

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 4, Tnfrsf4/Ox40 ELISA Kit
CK-bio-13846-01 48 Tests

Human Tumor necrosis factor receptor superfamily member 4, Tnfrsf4/Ox40 ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 4, Tnfrsf4/Ox40 ELISA Kit
CK-bio-13846-02 96 Tests

Human Tumor necrosis factor receptor superfamily member 4, Tnfrsf4/Ox40 ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 4, Tnfrsf4/Ox40 ELISA Kit
CK-bio-13846-03 5x 96 Tests

Human Tumor necrosis factor receptor superfamily member 4, Tnfrsf4/Ox40 ELISA Kit

Sign In for Pricing
View Details
Human Tumor necrosis factor receptor superfamily member 4, Tnfrsf4/Ox40 ELISA Kit
CK-bio-13846-04 10x 96 Tests

Human Tumor necrosis factor receptor superfamily member 4, Tnfrsf4/Ox40 ELISA Kit

Sign In for Pricing
View Details
Cleaved-COL1A2 (G1102) Polyclonal Antibody
MBS8591810-01 0.1 mg

Cleaved-COL1A2 (G1102) Polyclonal Antibody

Sign In for Pricing
View Details