Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOXF1 Peptide - C-terminal region

RHOXF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119030, MGC119033, OTEX, PEPP1

UniProt

Q8NHV9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHOXF1 Rabbit Polyclonal Antibody (orb577306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_644811

Preservative

Lyophilized powder

AA Sequence

ELESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD24 (M1/69) Rat Monoclonal Antibody (violetFluor™ 450 Conjugate)
CST 9705S 100 µg

CD24 (M1/69) Rat Monoclonal Antibody (violetFluor™ 450 Conjugate)

Sign In for Pricing
View Details
96 Fully Skirted Purple Frame
PCR1220 10 / PCK

96 Fully Skirted Purple Frame

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) α-2-HS-Glycoprotein/AHSG/Fetuin A (C-10His)
orb1648123-01 10 µg

Recombinant Macaca mulatta (Rhesus macaque) α-2-HS-Glycoprotein/AHSG/Fetuin A (C-10His)

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) α-2-HS-Glycoprotein/AHSG/Fetuin A (C-10His)
orb1648123-02 50 µg

Recombinant Macaca mulatta (Rhesus macaque) α-2-HS-Glycoprotein/AHSG/Fetuin A (C-10His)

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) α-2-HS-Glycoprotein/AHSG/Fetuin A (C-10His)
orb1648123-03 500 µg

Recombinant Macaca mulatta (Rhesus macaque) α-2-HS-Glycoprotein/AHSG/Fetuin A (C-10His)

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) α-2-HS-Glycoprotein/AHSG/Fetuin A (C-10His)
orb1648123-04 1 mg

Recombinant Macaca mulatta (Rhesus macaque) α-2-HS-Glycoprotein/AHSG/Fetuin A (C-10His)

Sign In for Pricing
View Details