Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOXF1 Peptide - C-terminal region

RHOXF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC119030, MGC119033, OTEX, PEPP1

UniProt

Q8NHV9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHOXF1 Rabbit Polyclonal Antibody (orb576425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_644811

Preservative

Lyophilized powder

AA Sequence

VPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS502691 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Ptpn11 Mouse Gene Knockout Kit (CRISPR)
KN314207RB 1 Kit

Ptpn11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Metallurgical Microscope BMIC-801
BMIC-801 1 Unit

Metallurgical Microscope BMIC-801

Sign In for Pricing
View Details
SLC34A2 Human Gene Knockout Kit (CRISPR)
KN218736LP 1 Kit

SLC34A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calbryte™ 630 AM
20720-AAT 2x 50 µg

Calbryte™ 630 AM

Sign In for Pricing
View Details
6,6'-((2R,5R)-1-(3,5-difluoro-4-(4-(4-fluorophenyl)piperidin-1-yl)phenyl)pyrrolidine-2,5-diyl)bis(5-fluoro-2-((S)-pyrrolidin-2-yl)-1H-benzo[d]imidazole)
TRC-D450903-25MG 25 mg

6,6'-((2R,5R)-1-(3,5-difluoro-4-(4-(4-fluorophenyl)piperidin-1-yl)phenyl)pyrrolidine-2,5-diyl)bis(5-fluoro-2-((S)-pyrrolidin-2-yl)-1H-benzo[d]imidazole)

Sign In for Pricing
View Details