RHOXF1 Peptide - C-terminal region
RHOXF1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC119030, MGC119033, OTEX, PEPP1
UniProt
Q8NHV9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RHOXF1 Rabbit Polyclonal Antibody (orb576425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_644811
Preservative
Lyophilized powder
AA Sequence
VPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELRADPDDCV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2755-500 1x 500 µL
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![BID Mouse Monoclonal Antibody [Clone ID: 24GB7035]](https://cdn.genprice.uk/products/937/68dd1b63061270361ea136a9/imageurl/ta425369.webp)
AP54150PU-N 400 µL
Tapasin Related Protein (TAPBPL) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![PI 3 Kinase catalytic subunit gamma (PIK3CG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G10]](https://cdn.genprice.uk/products/937/68dd1b70061270361ea17ff4/imageurl/ta505227bm.webp)
TA505227BM 100 µL
PI 3 Kinase catalytic subunit gamma (PIK3CG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G10]
Sign In for Pricing
View Details