Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIBC1 Peptide - middle region

RIBC1 Peptide - middle region

Product Specifications

Product Name Alternative

2610028I09Rik, FLJ32783, MGC46233

UniProt

Q8N443

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIBC1 Rabbit Polyclonal Antibody (orb325697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001026915

Preservative

Lyophilized powder

AA Sequence

ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Dengue Virus NS1 protein Antibody [Alexa Fluor 647]
NBP3-06439AF647 0.1 mL

Rabbit Polyclonal Dengue Virus NS1 protein Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Rabbit Polyclonal TIAL1 Antibody [DyLight 405]
NBP2-04047V 0.1 mL

Rabbit Polyclonal TIAL1 Antibody [DyLight 405]

Sign In for Pricing
View Details
CNNM1 Adenovirus (Rat)
16480056 1.0 mL

CNNM1 Adenovirus (Rat)

Sign In for Pricing
View Details
YE016 Antibody (Center) Blocking Peptide
MBS9219754-01 0.5 mg

YE016 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
YE016 Antibody (Center) Blocking Peptide
MBS9219754-02 5x 0.5 mg

YE016 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Mouse MAOB siRNA
abx923402-01 15 nmol

Mouse MAOB siRNA

Sign In for Pricing
View Details