Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIBC1 Peptide - middle region

RIBC1 Peptide - middle region

Product Specifications

Product Name Alternative

2610028I09Rik, FLJ32783, MGC46233

UniProt

Q8N443

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIBC1 Rabbit Polyclonal Antibody (orb325697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001026915

Preservative

Lyophilized powder

AA Sequence

ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lactoylglutathione lyase
orb1639288-01 50 µg

Lactoylglutathione lyase

Sign In for Pricing
View Details
Lactoylglutathione lyase
orb1639288-02 100 µg

Lactoylglutathione lyase

Sign In for Pricing
View Details
Lactoylglutathione lyase
orb1639288-03 1 mg

Lactoylglutathione lyase

Sign In for Pricing
View Details
Annexin A2 Antibody
MBS9204931-01 0.1 mL

Annexin A2 Antibody

Sign In for Pricing
View Details
Annexin A2 Antibody
MBS9204931-02 5x 0.1 mL

Annexin A2 Antibody

Sign In for Pricing
View Details
Recombinant Human STIP1
MBS7609769-01 0.05 mg

Recombinant Human STIP1

Sign In for Pricing
View Details