Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIC8A Peptide - N-terminal region

RIC8A Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC104517, MGC131931, MGC148073, MGC148074, RIC8, synembryn

UniProt

Q9NPQ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIC8A Rabbit Polyclonal Antibody (orb583617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068751

Preservative

Lyophilized powder

AA Sequence

KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF-02575799
MBS5769555 Inquire

PF-02575799

Sign In for Pricing
View Details
Lentiviral human MRPL11 shRNA (UAS) - Lentiviral human MRPL11 shRNA (UAS, GFP) (100)
GTR15349548 1 Vial

Lentiviral human MRPL11 shRNA (UAS) - Lentiviral human MRPL11 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
DDX6 Antibody (YA2252, Rabbit)
HY-P82507-01 10 µL

DDX6 Antibody (YA2252, Rabbit)

Sign In for Pricing
View Details
DDX6 Antibody (YA2252, Rabbit)
HY-P82507-02 50 μL

DDX6 Antibody (YA2252, Rabbit)

Sign In for Pricing
View Details
DDX6 Antibody (YA2252, Rabbit)
HY-P82507-03 100 µL

DDX6 Antibody (YA2252, Rabbit)

Sign In for Pricing
View Details
Mouse mmu-miR-20b-5p miRNA Antagomir
abx888088-01 10 nmol

Mouse mmu-miR-20b-5p miRNA Antagomir

Sign In for Pricing
View Details