Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIC8A Peptide - N-terminal region

RIC8A Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC104517, MGC131931, MGC148073, MGC148074, RIC8, synembryn

UniProt

Q9NPQ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIC8A Rabbit Polyclonal Antibody (orb583617) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068751

Preservative

Lyophilized powder

AA Sequence

KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WAY 126299A
orb1694876-01 25 mg

WAY 126299A

Sign In for Pricing
View Details
WAY 126299A
orb1694876-02 50 mg

WAY 126299A

Sign In for Pricing
View Details
WAY 126299A
orb1694876-03 100 mg

WAY 126299A

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces Pombe SPAC9E9.17c Protein (aa 18-72)
VAng-Yyj6471-500gEcoli 500 µg (E. coli)

Recombinant Schizosaccharomyces Pombe SPAC9E9.17c Protein (aa 18-72)

Sign In for Pricing
View Details
GSK3beta Rabbit pAb
MBS8541704-01 0.1 mL

GSK3beta Rabbit pAb

Sign In for Pricing
View Details
GSK3beta Rabbit pAb
MBS8541704-02 0.1 mL (AF405L)

GSK3beta Rabbit pAb

Sign In for Pricing
View Details