Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rimklb Peptide - middle region

Rimklb Peptide - middle region

Product Specifications

Product Name Alternative

4931417E21Rik, 4933426K21Rik, AA097693, AI325948, AU015629, Naags

UniProt

Q80WS1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rimklb Rabbit Polyclonal Antibody (orb326023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081940

Preservative

Lyophilized powder

AA Sequence

LFQKYIKESHGRDVRVIVVGGRVVGTMLRCSTDGRMQSNCSLGGVGMMCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r46 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV633569 1.0 µg DNA

Vom2r46 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CCL3 Antibody
KC-1557-01 50 μL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-1557-02 100 µL

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
KC-1557-03 1 mL

CCL3 Antibody

Sign In for Pricing
View Details
C1orf30 siRNA Oligos set (Human)
53697171 3x 5 nmol

C1orf30 siRNA Oligos set (Human)

Sign In for Pricing
View Details
WDR31 (h) -PR
sc-92542-PR 10 µM - 20 µL

WDR31 (h) -PR

Sign In for Pricing
View Details