Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rimklb Peptide - middle region

Rimklb Peptide - middle region

Product Specifications

Product Name Alternative

4931417E21Rik, 4933426K21Rik, AA097693, AI325948, AU015629, Naags

UniProt

Q80WS1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rimklb Rabbit Polyclonal Antibody (orb326023) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081940

Preservative

Lyophilized powder

AA Sequence

LFQKYIKESHGRDVRVIVVGGRVVGTMLRCSTDGRMQSNCSLGGVGMMCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf89 (TRABD2A) CytoSection
TS411756P5 25 Slides

C2orf89 (TRABD2A) CytoSection

Sign In for Pricing
View Details
ELAVL2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
19196151 3x 1.0 µg DNA

ELAVL2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Penta-O-acetylgluconyl Chloride
462158-01 25 mg

Penta-O-acetylgluconyl Chloride

Sign In for Pricing
View Details
Penta-O-acetylgluconyl Chloride
462158-02 50 mg

Penta-O-acetylgluconyl Chloride

Sign In for Pricing
View Details
SLC15A2 Rabbit Polyclonal Antibody
TA322236 100 µL

SLC15A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEN1 Conjugated Antibody
C43716 100 µL

MEN1 Conjugated Antibody

Sign In for Pricing
View Details