Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIOK2 Peptide - middle region

RIOK2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11159, RIO2

UniProt

Q9BVS4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIOK2 Rabbit Polyclonal Antibody (orb583488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060813

Preservative

Lyophilized powder

AA Sequence

IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxymethyl Polystyrene
H40000.5G 5 g

Hydroxymethyl Polystyrene

Sign In for Pricing
View Details
4-Ethylphenyl Sulfate Potassium Salt
TRC-E925865-250MG 250 mg

4-Ethylphenyl Sulfate Potassium Salt

Sign In for Pricing
View Details
GSTp1 Polyclonal Antibody
D-AB-10211L-01 25 µL

GSTp1 Polyclonal Antibody

Sign In for Pricing
View Details
GSTp1 Polyclonal Antibody
D-AB-10211L-02 100 µL

GSTp1 Polyclonal Antibody

Sign In for Pricing
View Details
N-(1-Ethylpropyl)-3,4-xylidine
TRC-E938678-1G 1 g

N-(1-Ethylpropyl)-3,4-xylidine

Sign In for Pricing
View Details
Human PIP5KL1 activation kit by CRISPRa
GA115309 1 Kit

Human PIP5KL1 activation kit by CRISPRa

Sign In for Pricing
View Details