Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIOK2 Peptide - middle region

RIOK2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11159, RIO2

UniProt

Q9BVS4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIOK2 Rabbit Polyclonal Antibody (orb583488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060813

Preservative

Lyophilized powder

AA Sequence

IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpastatin (CAST) Rabbit Polyclonal Antibody
TA374304 100 µL

Calpastatin (CAST) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human ApoA1 (Apolipoprotein A1) ELISA Kit
E-UNEL-H0205-01 5x 96 Tests

Uncoated Human ApoA1 (Apolipoprotein A1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human ApoA1 (Apolipoprotein A1) ELISA Kit
E-UNEL-H0205-02 15x 96 Tests

Uncoated Human ApoA1 (Apolipoprotein A1) ELISA Kit

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
hnRNP L (HNRNPL) (NM_001533) Human Over-expression Lysate
LY400589 100 µg

hnRNP L (HNRNPL) (NM_001533) Human Over-expression Lysate

Sign In for Pricing
View Details