Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RLF Peptide - N-terminal region

RLF Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC142226, ZN-15L, ZNF292L

UniProt

Q13129

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RLF Rabbit Polyclonal Antibody (orb324772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036553

Preservative

Lyophilized powder

AA Sequence

AVAGAGDGVETESMVRGHRPVSPAPGASGLRPCLWQLETELREQEVSEVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trans-Nerolidol
TRC-N385710-1G 1 g

trans-Nerolidol

Sign In for Pricing
View Details
Tissue FFPE Sections, Testis
CS805717 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details
Sodium Benzenethiolate (technical grade, 90%)
TRC-S930690-500MG 500 mg

Sodium Benzenethiolate (technical grade, 90%)

Sign In for Pricing
View Details
PISD Mouse Monoclonal Antibody [Clone ID: OTI6C3]
CF807333 100 µg

PISD Mouse Monoclonal Antibody [Clone ID: OTI6C3]

Sign In for Pricing
View Details
MRPS18A Human Gene Knockout Kit (CRISPR)
KN203070RB 1 Kit

MRPS18A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC25A45 (NM_001077241) Human Over-expression Lysate
LY421389 100 µg

SLC25A45 (NM_001077241) Human Over-expression Lysate

Sign In for Pricing
View Details