Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RLF Peptide - N-terminal region

RLF Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC142226, ZN-15L, ZNF292L

UniProt

Q13129

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RLF Rabbit Polyclonal Antibody (orb324772) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036553

Preservative

Lyophilized powder

AA Sequence

AVAGAGDGVETESMVRGHRPVSPAPGASGLRPCLWQLETELREQEVSEVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DP1 (TFDP1) Human Knockdown Lysate
LY300443 100 µg

DP1 (TFDP1) Human Knockdown Lysate

Sign In for Pricing
View Details
Human RD3 activation kit by CRISPRa
GA117558 1 Kit

Human RD3 activation kit by CRISPRa

Sign In for Pricing
View Details
FBXO17 Human Gene Knockout Kit (CRISPR)
KN402158 1 Kit

FBXO17 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Human/Mouse KLRG-1 Antibody[2F1]
E-AB-F1273A-01 25 µg

Purified Anti-Human/Mouse KLRG-1 Antibody[2F1]

Sign In for Pricing
View Details
Purified Anti-Human/Mouse KLRG-1 Antibody[2F1]
E-AB-F1273A-02 100 µg

Purified Anti-Human/Mouse KLRG-1 Antibody[2F1]

Sign In for Pricing
View Details
COL5A2 Rabbit Polyclonal Antibody
TA384037 100 µL

COL5A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details