RLN1 Peptide - middle region
RLN1 Peptide - middle region
Product Specifications
Product Name Alternative
H1, RLXH1, bA12D24.3.1, bA12D24.3.2
UniProt
P04808
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RLN1 Rabbit Polyclonal Antibody (orb330887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_008842
Preservative
Lyophilized powder
AA Sequence
EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2474-100 1x 100 µL
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), 0.2mg/mL
Sign In for Pricing
View Details 
TP310458 20 µg
Nucleophosmin (NPM1) (NM_001037738) Human Recombinant Protein
Sign In for Pricing
View Details ![MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: OTI4F3]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908d5a/imageurl/cf812455.webp)
CF812455 100 µg
MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: OTI4F3]
Sign In for Pricing
View Details 