Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RLN1 Peptide - middle region

RLN1 Peptide - middle region

Product Specifications

Product Name Alternative

H1, RLXH1, bA12D24.3.1, bA12D24.3.2

UniProt

P04808

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RLN1 Rabbit Polyclonal Antibody (orb330887) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008842

Preservative

Lyophilized powder

AA Sequence

EIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OC90 (Center) Rabbit Polyclonal Antibody
AP52986PU-N 400 µL

OC90 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Synovium
CS714269 5x 5 µm

Tissue FFPE Sections, Synovium

Sign In for Pricing
View Details
MPIG6B Human Gene Knockout Kit (CRISPR)
KN215589RB 1 Kit

MPIG6B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SOX1 Monoclonal Antibody
AN301660L-01 50 µL

Recombinant SOX1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SOX1 Monoclonal Antibody
AN301660L-02 100 µL

Recombinant SOX1 Monoclonal Antibody

Sign In for Pricing
View Details