Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RND1 Peptide - C-terminal region

RND1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARHS, FLJ42294, RHO6, RHOS

UniProt

Q92730

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RND1 Rabbit Polyclonal Antibody (orb326396) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055285

Preservative

Lyophilized powder

AA Sequence

ASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Leptospira Biflexa rpmI protein (aa 1-66)
VAng-Wyb0171-50gEcoli 50 µg (E. coli)

Recombinant Leptospira Biflexa rpmI protein (aa 1-66)

Sign In for Pricing
View Details
Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)
MBS1448001-01 0.02 mg (E-Coli)

Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)

Sign In for Pricing
View Details
Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)
MBS1448001-02 0.02 mg (Yeast)

Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)

Sign In for Pricing
View Details
Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)
MBS1448001-03 0.1 mg (E-Coli)

Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)

Sign In for Pricing
View Details
Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)
MBS1448001-04 0.1 mg (Yeast)

Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)

Sign In for Pricing
View Details
Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)
MBS1448001-05 0.02 mg (Baculovirus)

Recombinant Human PI-PLC X domain-containing protein 3 (PLCXD3)

Sign In for Pricing
View Details