Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF11L2 Peptide - C-terminal region

RNF11L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Rnf11l

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_237327

Preservative

Lyophilized powder

AA Sequence

GLIQHLPKGGYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 / NCAM (123A8, same as 56C04), 0.2mg/mL
BNUB0692-100 1x 100 µL

CD56 / NCAM (123A8, same as 56C04), 0.2mg/mL

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD11a Antibody[FD441.8]
E-AB-F1033UM-02 100 µg

Elab Fluor® 647 Anti-Mouse CD11a Antibody[FD441.8]

Sign In for Pricing
View Details
ELAVL1 Human Gene Knockout Kit (CRISPR)
KN401562 1 Kit

ELAVL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ɑ-Biotinamido-ω-Mercaptopropanamido PEG
1310000-25-4.500MG 500 mg

Ɑ-Biotinamido-ω-Mercaptopropanamido PEG

Sign In for Pricing
View Details
Urolithin M6
TRC-U847040-10MG 10 mg

Urolithin M6

Sign In for Pricing
View Details