Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF11L2 Peptide - C-terminal region

RNF11L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Rnf11l

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_237327

Preservative

Lyophilized powder

AA Sequence

GLIQHLPKGGYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRGBP Antibody
KC-37128-01 50 μL

MRGBP Antibody

Sign In for Pricing
View Details
MRGBP Antibody
KC-37128-02 100 µL

MRGBP Antibody

Sign In for Pricing
View Details
MRGBP Antibody
KC-37128-03 1 mL

MRGBP Antibody

Sign In for Pricing
View Details
KIAA0556 Polyclonal Antibody
E-AB-52101-01 20 µL

KIAA0556 Polyclonal Antibody

Sign In for Pricing
View Details
KIAA0556 Polyclonal Antibody
E-AB-52101-02 60 µL

KIAA0556 Polyclonal Antibody

Sign In for Pricing
View Details
KIAA0556 Polyclonal Antibody
E-AB-52101-03 120 µL

KIAA0556 Polyclonal Antibody

Sign In for Pricing
View Details