Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF128 Peptide - C-terminal region

RNF128 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ23516, GRAIL

UniProt

Q8TEB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF128 Rabbit Polyclonal Antibody (orb584228) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078815

Preservative

Lyophilized powder

AA Sequence

PMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CHI3L1 Knockout HEK293T cell line
GTR15418835 1 Vial

Human CHI3L1 Knockout HEK293T cell line

Sign In for Pricing
View Details
TRβ2 shRNA (m) Lentiviral Particles
sc-45906-V 200 µL

TRβ2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Mmu-miR-6985-3p miRNA Mimic
orb1874727-01 5 nmol

Mmu-miR-6985-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-6985-3p miRNA Mimic
orb1874727-02 10 nmol

Mmu-miR-6985-3p miRNA Mimic

Sign In for Pricing
View Details
Folic Acid
AT062 1mg

Folic Acid

Sign In for Pricing
View Details
ZNF583 CytoSection
TS428964P5 25 Slides

ZNF583 CytoSection

Sign In for Pricing
View Details