Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF128 Peptide - C-terminal region

RNF128 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ23516, GRAIL

UniProt

Q8TEB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF128 Rabbit Polyclonal Antibody (orb584228) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078815

Preservative

Lyophilized powder

AA Sequence

PMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC57, CT (LRRC57, Leucine-rich repeat-containing protein 57) (PE) discontinued
037967-PE 200 µL

LRRC57, CT (LRRC57, Leucine-rich repeat-containing protein 57) (PE) discontinued

Sign In for Pricing
View Details
CD300LB siRNA (m)
sc-142193 10 µM

CD300LB siRNA (m)

Sign In for Pricing
View Details
Lentiviral human SLC4A8 shRNA (UAS) - Lentiviral human SLC4A8 shRNA (UAS, RFP) (25)
GTR15106055 1 Vial

Lentiviral human SLC4A8 shRNA (UAS) - Lentiviral human SLC4A8 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain JAY291)(Baker's yeast) TOS6 Polyclonal Antibody
MBS7179411 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain JAY291)(Baker's yeast) TOS6 Polyclonal Antibody

Sign In for Pricing
View Details
C Kit (KIT) Mouse Monoclonal Antibody [Clone 1F6]
E45M14959V-2 50 µL

C Kit (KIT) Mouse Monoclonal Antibody [Clone 1F6]

Sign In for Pricing
View Details
Recombinant Balaenoptera musculus Cytochrome c oxidase subunit 2 (MT-CO2)
MBS1025505 Inquire

Recombinant Balaenoptera musculus Cytochrome c oxidase subunit 2 (MT-CO2)

Sign In for Pricing
View Details