Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf14 Peptide - N-terminal region

Rnf14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARA54

UniProt

Q3ZAU6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rnf14 Rabbit Polyclonal Antibody (orb574793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001030167

Preservative

Lyophilized powder

AA Sequence

SAEDLEAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Tyrosinase, TYR ELISA KIT
E0098Gp-01 48 Well

Guinea Pig Tyrosinase, TYR ELISA KIT

Sign In for Pricing
View Details
Guinea Pig Tyrosinase, TYR ELISA KIT
E0098Gp-02 96 Well

Guinea Pig Tyrosinase, TYR ELISA KIT

Sign In for Pricing
View Details
Guinea Pig Tyrosinase, TYR ELISA KIT
E0098Gp-03 5x 96 Tests

Guinea Pig Tyrosinase, TYR ELISA KIT

Sign In for Pricing
View Details
Guinea Pig Tyrosinase, TYR ELISA KIT
E0098Gp-04 10x 96 Tests

Guinea Pig Tyrosinase, TYR ELISA KIT

Sign In for Pricing
View Details
RNF7 (N-term) Rabbit pAb
E2619171 100 µL

RNF7 (N-term) Rabbit pAb

Sign In for Pricing
View Details
PNPT1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
37126126 3x 1.0µg DNA

PNPT1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details