Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf141 Peptide - N-terminal region

Rnf141 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2610110L04Rik, AA792898, AU022812, ZFP36, ZNF230

UniProt

Q99MB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rnf141 Rabbit Polyclonal Antibody (orb324550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080275

Preservative

Lyophilized powder

AA Sequence

SDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVAAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fast Plus EvaGreen® qPCR Master Mix with high Rox (5000 rxn)
#31015-2 50x 1 mL

Fast Plus EvaGreen® qPCR Master Mix with high Rox (5000 rxn)

Sign In for Pricing
View Details
RNA Polymerase II (CTD4H8), CF740 conjugate, 0.1mg/mL
BNC742929-500 1x 500 µL

RNA Polymerase II (CTD4H8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polyquaternium-37
TRC-P689365-500MG 500 mg

Polyquaternium-37

Sign In for Pricing
View Details
WDR19 Human Gene Knockout Kit (CRISPR)
KN424322 1 Kit

WDR19 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Abamectin B1a
TRC-A794665-1MG 1 mg

Abamectin B1a

Sign In for Pricing
View Details
CD302 Antibody
8C12150-AAT 50 µg

CD302 Antibody

Sign In for Pricing
View Details