Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf141 Peptide - N-terminal region

Rnf141 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2610110L04Rik, AA792898, AU022812, ZFP36, ZNF230

UniProt

Q99MB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rnf141 Rabbit Polyclonal Antibody (orb324550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080275

Preservative

Lyophilized powder

AA Sequence

SDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVAAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT6 Rabbit Polyclonal Antibody
AP02592PU-N 100 µL

STAT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Rit1 activation kit by CRISPRa
GA203643 1 Kit

Mouse Rit1 activation kit by CRISPRa

Sign In for Pricing
View Details
5-HT (Serotonin) Recombinant Rabbit Monoclonal Antibody [PSH06-05]
HA722504 100 µL

5-HT (Serotonin) Recombinant Rabbit Monoclonal Antibody [PSH06-05]

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3280), CF405S conjugate, 0.1mg/mL
BNC043280-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3280), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CRTAM Polyclonal Antibody
E-AB-10260-01 20 µL

CRTAM Polyclonal Antibody

Sign In for Pricing
View Details
CRTAM Polyclonal Antibody
E-AB-10260-02 60 µL

CRTAM Polyclonal Antibody

Sign In for Pricing
View Details