Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rod1 Peptide - N-terminal region

Rod1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

5830471K22Rik, AA407443, AI462022, AW107884, C86549, MGC11742, Rod1

UniProt

Q8BHD7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rod1 Rabbit Polyclonal Antibody (orb577671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659153

Preservative

Lyophilized powder

AA Sequence

YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-VAD-FMK
TRC-Z359870-5MG 5 mg

Z-VAD-FMK

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS633518 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Villin Antibody
KC-245-01 50 μL

Villin Antibody

Sign In for Pricing
View Details
Villin Antibody
KC-245-02 100 µL

Villin Antibody

Sign In for Pricing
View Details
Villin Antibody
KC-245-03 1 mL

Villin Antibody

Sign In for Pricing
View Details
TMEM16B (ANO2) Human Gene Knockout Kit (CRISPR)
KN422601 1 Kit

TMEM16B (ANO2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details