Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Romo1 Peptide - N-terminal region

Romo1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2010100O12Rik, AI853864, RP23-107C23.2

UniProt

A2AHC3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Romo1 Rabbit Polyclonal Antibody (orb583989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001108548

Preservative

Lyophilized powder

AA Sequence

PVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diras1 (NM_145217) Mouse Tagged ORF Clone
MG201966 10 µg

Diras1 (NM_145217) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SMARCD3 (NM_001003802) Human Over-expression Lysate
LC424015 20 µg

SMARCD3 (NM_001003802) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Chloropropylamine Hydrochloride
TRC-C379440-25G 25 g

3-Chloropropylamine Hydrochloride

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), 1mg/mL
BNUM0637-50 1x 50 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), 1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (ECM1/792), CF594 conjugate, 0.1mg/mL
BNC940792-500 1x 500 µL

IgA Secretory Component (ECM1/792), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rpgrip1 Mouse Gene Knockout Kit (CRISPR)
KN515006 1 Kit

Rpgrip1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details