Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Romo1 Peptide - N-terminal region

Romo1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2010100O12Rik, AI853864, RP23-107C23.2

UniProt

A2AHC3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Romo1 Rabbit Polyclonal Antibody (orb583989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001108548

Preservative

Lyophilized powder

AA Sequence

PVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thiothiamine-13C3
TRC-T375252-25MG 25 mg

Thiothiamine-13C3

Sign In for Pricing
View Details
Recombinant Human LEPTIN Protein (GST Tag)
PDEH101125-01 20 µg

Recombinant Human LEPTIN Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human LEPTIN Protein (GST Tag)
PDEH101125-02 100 µg

Recombinant Human LEPTIN Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human LEPTIN Protein (GST Tag)
PDEH101125-03 500 µg

Recombinant Human LEPTIN Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human LEPTIN Protein (GST Tag)
PDEH101125-04 1 mg

Recombinant Human LEPTIN Protein (GST Tag)

Sign In for Pricing
View Details
Nicotine-d3 N-(4-Deoxy-4,5-didehydro)-Beta-D-glucuronide
TRC-N414255-5MG 5 mg

Nicotine-d3 N-(4-Deoxy-4,5-didehydro)-Beta-D-glucuronide

Sign In for Pricing
View Details