Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROPN1L Peptide - C-terminal region

ROPN1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

ASP, FLJ23003, FLJ25776, RSPH11

UniProt

Q96C74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ROPN1L Rabbit Polyclonal Antibody (orb584722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114122

Preservative

Lyophilized powder

AA Sequence

DVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDVGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD279/PD-1 Antibody[J110]
E-AB-F1213A-01 25 µg

Purified Anti-Human CD279/PD-1 Antibody[J110]

Sign In for Pricing
View Details
Purified Anti-Human CD279/PD-1 Antibody[J110]
E-AB-F1213A-02 100 µg

Purified Anti-Human CD279/PD-1 Antibody[J110]

Sign In for Pricing
View Details
Bcl-2 (100/D5 + 124), CF568 conjugate, 0.1mg/mL
BNC681234-100 1x 100 µL

Bcl-2 (100/D5 + 124), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Fluoropyrazin-2-amine
TRC-F402028-5MG 5 mg

3-Fluoropyrazin-2-amine

Sign In for Pricing
View Details
Spinetoram
TRC-S683653-5MG 5 mg

Spinetoram

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), CF640R conjugate, 0.1mg/mL
BNC401776-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (N/A), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details