Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROPN1L Peptide - C-terminal region

ROPN1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

ASP, FLJ23003, FLJ25776, RSPH11

UniProt

Q96C74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ROPN1L Rabbit Polyclonal Antibody (orb584722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114122

Preservative

Lyophilized powder

AA Sequence

DVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDVGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromothioanisole
TRC-B688165-2.5G 2.5 g

3-Bromothioanisole

Sign In for Pricing
View Details
Frozen Tissue Sections, Vagina
CS636500 5x 5 µm

Frozen Tissue Sections, Vagina

Sign In for Pricing
View Details
Plasma/Serum RNA Purification Maxi Kit
56200 10 Preparations

Plasma/Serum RNA Purification Maxi Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS621237 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Contactin 1 (CNTN1) (NM_175038) Human Recombinant Protein
TP320493L 1 mg

Contactin 1 (CNTN1) (NM_175038) Human Recombinant Protein

Sign In for Pricing
View Details
DCL 1 (CD302) (Center) Rabbit Polyclonal Antibody
AP17271PU-N 400 µL

DCL 1 (CD302) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details