Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROPN1L Peptide - N-terminal region

ROPN1L Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASP, FLJ23003, FLJ25776, RSPH11

UniProt

Q96C74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ROPN1L Rabbit Polyclonal Antibody (orb584723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114122

Preservative

Lyophilized powder

AA Sequence

GYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frizzled homolog 1 (FZD1) Rabbit Polyclonal Antibody
AP01203PU-N 100 µg

Frizzled homolog 1 (FZD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CCDC11 (CFAP53) activation kit by CRISPRa
GA116565 1 Kit

Human CCDC11 (CFAP53) activation kit by CRISPRa

Sign In for Pricing
View Details
3110009E18Rik Mouse Gene Knockout Kit (CRISPR)
KN500311 1 Kit

3110009E18Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tyk2 Rabbit Polyclonal Antibody
ER1803-05 100 µL

Tyk2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GTDC1 (NM_024659) Human Recombinant Protein
TP304594 20 µg

GTDC1 (NM_024659) Human Recombinant Protein

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2425), CF568 conjugate, 0.1mg/mL
BNC682425-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2425), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details