Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROPN1L Peptide - N-terminal region

ROPN1L Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASP, FLJ23003, FLJ25776, RSPH11

UniProt

Q96C74

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ROPN1L Rabbit Polyclonal Antibody (orb584723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114122

Preservative

Lyophilized powder

AA Sequence

GYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD350 amine
70001-AAT 1 mg

XFD350 amine

Sign In for Pricing
View Details
APPBP1 (NAE1) Mouse Monoclonal Antibody [Clone ID: OTI1A8]
CF804284 100 µg

APPBP1 (NAE1) Mouse Monoclonal Antibody [Clone ID: OTI1A8]

Sign In for Pricing
View Details
Lomefloxacin
TRC-L469418-10MG 10 mg

Lomefloxacin

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS503207 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
CD34 Monoclonal Antibody
AN200012P 100 µL

CD34 Monoclonal Antibody

Sign In for Pricing
View Details
UGCGL2 (UGGT2) Rabbit Polyclonal Antibody
TA367832 100 µL

UGCGL2 (UGGT2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details