Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rorc Peptide - N-terminal region

Rorc Peptide - N-terminal region

Product Specifications

Product Name Alternative

Nr1f3, RORgamma, TOR, Thor

UniProt

P51450

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rorc Rabbit Polyclonal Antibody (orb329909) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_035411

Preservative

Lyophilized powder

AA Sequence

VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK10 (NM_052988) Human Recombinant Protein
TP322310 20 µg

CDK10 (NM_052988) Human Recombinant Protein

Sign In for Pricing
View Details
Dibenzyl Azodicarboxylate
TRC-D417215-1G 1 g

Dibenzyl Azodicarboxylate

Sign In for Pricing
View Details
Butanal-d8
TRC-B689892-10MG 10 mg

Butanal-d8

Sign In for Pricing
View Details
GALK1 (C-term) Rabbit Polyclonal Antibody
AP13661PU-N 400 µL

GALK1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS705720 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Neptune Filter Tips 10-100 µL Universal Fit Racked, Low Retention, Pre-Sterilized
BT100 96 Tips/Rack - 10 Racks/PK

Neptune Filter Tips 10-100 µL Universal Fit Racked, Low Retention, Pre-Sterilized

Sign In for Pricing
View Details